General Information

  • ID:  hor006805
  • Uniprot ID:  A4QNN7
  • Protein name:  Transthyretin
  • Gene name:  ttr
  • Organism:  Xenopus tropicalis
  • Family:  Transthyretin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana; Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
  • GO MF:  GO:0005576 extracellular region
  • GO BP:  GO:0005179 hormone activity; GO:0042802 identical protein binding; GO:0070324 thyroid hormone binding
  • GO CC:  NA

Sequence Information

  • Sequence:  PGHVSHGEADSKCPLMVKVLDAVRGIPAANLLVQVFRNTEGNWELISSGKTTELGEIHNIITDEQFTEGVYKIEFATKTFWRKLGLSPFHEYVDVVFSANDAGHRHYTIAVLLTPYSISSTAVVSEPHDDL
  • Length:  131
  • Propeptide:  MAFFKSFLLLALLAIASEAAPGHVSHGEADSKCPLMVKVLDAVRGIPAANLLVQVFRNTEGNWELISSGKTTELGEIHNIITDEQFTEGVYKIEFATKTFWRKLGLSPFHEYVDVVFSANDAGHRHYTIAVLLTPYSISSTAVVSEPHDDL
  • Signal peptide:  MAFFKSFLLLALLAIASEA
  • Modification:  T1 N-acetylmethionine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Thyroid hormone-binding protein, with a much higher binding affinity for triiodothyronine (T3) than for thyroxine (T4).
  • Mechanism:  Thyroid hormone-binding protein, with a much higher binding affinity for triiodothyronine (T3) than for thyroxine (T4).
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA